Recombinant Full Length Human NKAIN2 Protein, GST-tagged

• Cat.No.: NKAIN2-6647HF
• Product Overview: Human NKAIN2 full-length ORF ( AAH35062.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: NKAIN2 is a member of a family of mammalian proteins (see NKAIN1; MIM 612871) with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330) (Gorokhova et al., 2007 [PubMed 17606467]).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.2 kDa
• Protein length: 207 amino acids
• AA Sequence: MGIIRFLLLYCPTNILTVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRYITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSVTPAPDWAPEDHRYITVSGCLLEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQLQPMYMSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NKAIN2 Na+/K+ transporting ATPase interacting 2 [ Homo sapiens(human) ]
• Official Symbol: NKAIN2
• Synonyms: NKAIN2; TCBA; TCBA1; FAM77B; NKAIP2; Na+/K+ transporting ATPase interacting 2; sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2; T-cell lymphoma breakpoint-associated target protein 1; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2
• Gene ID: 154215
• mRNA Refseq: NM_001040214
• Protein Refseq: NP_001035304
• MIM: 609758
• UniProt ID: Q5VXU1