Recombinant Human NKAIN2 protein, GST-tagged

• Cat.No.: NKAIN2-1298H
• Product Overview: Recombinant Human NKAIN2 protein(112-163 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 112-163 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: PGCTVTSVTPAPDWAPEDHRYITVSGCLLEYQYIEVAHSSLQIVLALAGFIY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: NKAIN2
• Synonyms: NKAIN2; TCBA; TCBA1; FAM77B; NKAIP2; Na+/K+ transporting ATPase interacting 2; sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2; T-cell lymphoma breakpoint-associated target protein 1; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2
• Gene ID: 154215
• mRNA Refseq: NM_001040214
• Protein Refseq: NP_001035304
• MIM: 609758
• UniProt ID: Q5VXU1