Recombinant Full Length Human NIPSNAP3A Protein, GST-tagged

• Cat.No.: NIPSNAP3A-6637HF
• Product Overview: Human NIPSNAP3A full-length ORF ( NP_056284.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 247 amino acids
• Description: NIPSNAP3A belongs to a family of proteins with putative roles in vesicular transport (Buechler et al., 2004 [PubMed 15177564]).[supplied by OMIM
• Molecular Mass: 54.9 kDa
• AA Sequence: MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NIPSNAP3A nipsnap homolog 3A (C. elegans) [ Homo sapiens ]
• Official Symbol: NIPSNAP3A
• Synonyms: NIPSNAP3A; nipsnap homolog 3A (C. elegans); protein NipSnap homolog 3A; DKFZp564D177; FLJ13953; HSPC299; MGC14553; protein NipSnap homolog 4; target for Salmonella secreted protein C; TASSC; NIPSNAP4
• Gene ID: 25934
• mRNA Refseq: NM_015469
• Protein Refseq: NP_056284
• MIM: 608871
• UniProt ID: Q9UFN0