Recombinant Full Length Human NIPSNAP3A Protein, C-Flag-tagged

• Cat.No.: NIPSNAP3A-1404HFL
• Product Overview: Recombinant Full Length Human NIPSNAP3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: NIPSNAP3A belongs to a family of proteins with putative roles in vesicular transport.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 28.3 kDa
• AA Sequence: MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELV GYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKP PKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGR
  HKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: NIPSNAP3A nipsnap homolog 3A [ Homo sapiens (human) ]
• Official Symbol: NIPSNAP3A
• Synonyms: TASSC; HSPC299; NIPSNAP4
• Gene ID: 25934
• mRNA Refseq: NM_015469.3
• Protein Refseq: NP_056284.1
• MIM: 608871
• UniProt ID: Q9UFN0