Recombinant Full Length Human NFE2 Protein
Cat.No. : | NFE2-341HF |
Product Overview : | Recombinant full length Human Nuclear Factor Erythroid Derived 2 with N terminal proprietary tag. Predicted MW 66.77 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 373 amino acids |
Description : | Transcription factor NF-E2 45 kDa subunit is a protein that in humans is encoded by the NFE2 gene. |
Form : | Liquid |
Molecular Mass : | 66.770kDa inclusive of tags |
AA Sequence : | MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGL NAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPP PPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPL QDPLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLEL EGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAE TPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTD KIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLE VMRQQLTELYRDIFQHLRDESGNSYSPEEYALQQAADGTI FLVPRGTKMEATD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | NFE2 nuclear factor (erythroid-derived 2), 45kDa [ Homo sapiens ] |
Official Symbol | NFE2 |
Synonyms | NFE2; nuclear factor (erythroid-derived 2), 45kDa; nuclear factor (erythroid derived 2), 45kD; transcription factor NF-E2 45 kDa subunit; NFE2 |
Gene ID | 4778 |
mRNA Refseq | NM_001136023 |
Protein Refseq | NP_001129495 |
MIM | 601490 |
UniProt ID | Q16621 |
◆ Recombinant Proteins | ||
Retnlg-3716M | Recombinant Mouse Retnlg, His-tagged | +Inquiry |
SCO1867-1326S | Recombinant Streptomyces coelicolor A3(2) SCO1867 protein, His-tagged | +Inquiry |
RFL25416CF | Recombinant Full Length Clostridium Beijerinckii Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
NOTCH3-4028R | Recombinant Rat NOTCH3 Protein | +Inquiry |
ATOH8-4946Z | Recombinant Zebrafish ATOH8 | +Inquiry |
◆ Native Proteins | ||
MUC1-376H | Active Native Human MUC1 | +Inquiry |
PROS1-31218TH | Native Human PROS1 Protein | +Inquiry |
Fetuin-5263B | Native Bovine Fetuin Protein | +Inquiry |
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACKR4-171HCL | Recombinant Human ACKR4 lysate | +Inquiry |
MAT2B-4452HCL | Recombinant Human MAT2B 293 Cell Lysate | +Inquiry |
ERBB2-465HCL | Recombinant Human ERBB2 cell lysate | +Inquiry |
STK17A-1712HCL | Recombinant Human STK17A cell lysate | +Inquiry |
PLEKHG4-1376HCL | Recombinant Human PLEKHG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFE2 Products
Required fields are marked with *
My Review for All NFE2 Products
Required fields are marked with *
0
Inquiry Basket