Recombinant Full Length Human Neuromedin-U Receptor 2(Nmur2) Protein, His-Tagged
Cat.No. : | RFL12847HF |
Product Overview : | Recombinant Full Length Human Neuromedin-U receptor 2(NMUR2) Protein (Q9GZQ4) (1-415aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-415) |
Form : | Lyophilized powder |
AA Sequence : | MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGV IGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCY FKTALFETVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLP NTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMA LRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEEWSES LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPA QRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NMUR2 |
Synonyms | NMUR2; NMU2R; TGR1; Neuromedin-U receptor 2; NMU-R2; G-protein coupled receptor FM-4; G-protein coupled receptor TGR-1 |
UniProt ID | Q9GZQ4 |
◆ Recombinant Proteins | ||
Il12B&Il23A-0300H | Recombinant Human Il12B&Il23A protein, His-tagged, Biotinylated | +Inquiry |
FABP1-5766C | Recombinant Chicken FABP1 | +Inquiry |
EFCAB7-1388R | Recombinant Rhesus monkey EFCAB7 Protein, His-tagged | +Inquiry |
CSNK1E-0203H | Recombinant Human CSNK1E Protein (E2-K416), GST tagged | +Inquiry |
RFL21587OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Vacuolar Iron Transporter Homolog 2 (Os04G0538400, Loc_Os04G45520) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
Collagen-121H | Native Human Collagen Type IV protein | +Inquiry |
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
Proteoglycans-50B | Native Bovine Proteoglycans | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDF2L1-2012HCL | Recombinant Human SDF2L1 293 Cell Lysate | +Inquiry |
NFATC1-3858HCL | Recombinant Human NFATC1 293 Cell Lysate | +Inquiry |
GLIS1-5901HCL | Recombinant Human GLIS1 293 Cell Lysate | +Inquiry |
OCIAD2-3604HCL | Recombinant Human OCIAD2 293 Cell Lysate | +Inquiry |
OCLN-3603HCL | Recombinant Human OCLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMUR2 Products
Required fields are marked with *
My Review for All NMUR2 Products
Required fields are marked with *
0
Inquiry Basket