Recombinant Full Length Bovine Neuromedin-U Receptor 2(Nmur2) Protein, His-Tagged
Cat.No. : | RFL30209BF |
Product Overview : | Recombinant Full Length Bovine Neuromedin-U receptor 2(NMUR2) Protein (Q58CW4) (1-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-407) |
Form : | Lyophilized powder |
AA Sequence : | MEKHENVSWMYQQELKDPFKKYLNNTDDYLALLCGPRRSHLFLPVTAVYALIFVVGVVGN LLVCLVILRHQTMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCYFKT ALFETVCFASILSVTTVSVERYVAVLHPFRAKLKSTRGRALRILGIVWGLSVLFSLPNTS IHGIKLHYFPNGSIIPGSATCTVIKPMWIYNFIIQVTSLLFYILPMTVISVLYYLMGLKL KKDQHLEADKVTANIQRPSRKSVTKMLFVLVLVFAICWAPFHIDRLFFSFVEEWTEPLAA VFNLIHVVSGVFFYLSSAVNPIIYNLLSHRFQAAFRTVIPPSCQQQHSHNHSPGPSMQRN IFLTECHLVELTEDVAPQFPRQLSVLSSQLPTALCTGQVPRKELAKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NMUR2 |
Synonyms | NMUR2; Neuromedin-U receptor 2; NMU-R2 |
UniProt ID | Q58CW4 |
◆ Recombinant Proteins | ||
RFL10541RF | Recombinant Full Length Rat E3 Ubiquitin-Protein Ligase March11(March11) Protein, His-Tagged | +Inquiry |
DGCR6L-2494HF | Recombinant Full Length Human DGCR6L Protein, GST-tagged | +Inquiry |
CSK-576H | Recombinant Human CSK Protein, His-tagged | +Inquiry |
DISC1-1873R | Recombinant Rat DISC1 Protein | +Inquiry |
EIF2B1-3511H | Recombinant Human EIF2B1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1815P | Active Native Peanut Lectin Protein, Cy5 labeled | +Inquiry |
CLU-19H | Native Human Clusterin Protein | +Inquiry |
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
HDL-201H | Native Human High Density Lipoprotein | +Inquiry |
PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF449-71HCL | Recombinant Human ZNF449 293 Cell Lysate | +Inquiry |
PROKR2-2834HCL | Recombinant Human PROKR2 293 Cell Lysate | +Inquiry |
MYBPHL-4040HCL | Recombinant Human MYBPHL 293 Cell Lysate | +Inquiry |
RPS27A-2165HCL | Recombinant Human RPS27A 293 Cell Lysate | +Inquiry |
GSTM1-5713HCL | Recombinant Human GSTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMUR2 Products
Required fields are marked with *
My Review for All NMUR2 Products
Required fields are marked with *
0
Inquiry Basket