Recombinant Full Length Human MTPN Protein, GST-tagged

Cat.No. : MTPN-6558HF
Product Overview : Human MTPN full-length ORF ( AAH28093, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3 end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 38.72 kDa
Protein length : 118 amino acids
AA Sequence : MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTPN myotrophin [ Homo sapiens ]
Official Symbol MTPN
Synonyms MTPN; myotrophin; GCDP; granule cell differentiation protein; MYOTROPHIN; V 1;
Gene ID 94351
MIM 606484
UniProt ID P58546

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MTPN Products

Required fields are marked with *

My Review for All MTPN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon