Recombinant Full Length Human MTIF3 Protein, GST-tagged

• Cat.No.: MTIF3-6531HF
• Product Overview: Human MTIF3 full-length ORF ( NP_690876.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 278 amino acids
• Description: This gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism in this gene is associated with the onset of Parkinson's disease. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Oct 2009]
• Molecular Mass: 58.1 kDa
• AA Sequence: MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTIF3 mitochondrial translational initiation factor 3 [ Homo sapiens ]
• Official Symbol: MTIF3
• Synonyms: MTIF3; mitochondrial translational initiation factor 3; translation initiation factor IF-3, mitochondrial; IF 3mt; IF3(mt); IF-3(Mt); IF3mt; FLJ33676
• Gene ID: 219402
• mRNA Refseq: NM_001166261
• Protein Refseq: NP_001159733
• MIM: 619554
• UniProt ID: Q9H2K0