Recombinant Full Length Human MTF1 Protein, C-Flag-tagged
Cat.No. : | MTF1-777HFL |
Product Overview : | Recombinant Full Length Human MTF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 80.8 kDa |
AA Sequence : | MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCGEH LPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY QCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKAFLTSYSLRIHVRVHTKEKPFECDVQGCEKA FNTLYRLKAHQRLHTGKTFNCESEGCSKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHV RTHTGERPFFCPSNGCEKTFSTQYSLKSHMKGHDNKGHSYNALPQHNGSEDTNHSLCLSDLSLLSTDSEL RENSSTTQGQDLSTISPAIIFESMFQNSDDTAIQEDPQQTASLTESFNGDAESVSDVPPSTGNSASLSLP LVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQEFLPHPQ APQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAI LQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPGSSVQQIGLSVPVIIIKQEE ACQCQCACRDSAKERASSRRKGCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQ AETPSDPQTETLSAMDVSEFLSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | MTF1 metal regulatory transcription factor 1 [ Homo sapiens (human) ] |
Official Symbol | MTF1 |
Synonyms | ZRF; MTF-1 |
Gene ID | 4520 |
mRNA Refseq | NM_005955.3 |
Protein Refseq | NP_005946.2 |
MIM | 600172 |
UniProt ID | Q14872 |
◆ Recombinant Proteins | ||
PM20D1-3652H | Recombinant Human PM20D1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PYHIN1-13754M | Recombinant Mouse PYHIN1 Protein | +Inquiry |
SNRPE-4198R | Recombinant Rhesus Macaque SNRPE Protein, His (Fc)-Avi-tagged | +Inquiry |
ACKR1-01H | Active Recombinant Human ACKR1 Full Length Transmembrane protein, His-tagged | +Inquiry |
Cd226-5756M | Recombinant Mouse Cd226 Protein (Glu19-Pro254), C-His tagged | +Inquiry |
◆ Native Proteins | ||
MG-41H | Active Native Human MG | +Inquiry |
Lectin-1830R | Active Native Ricinus Communis Agglutinin I Protein, Agarose bound | +Inquiry |
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAQ-230HCL | Recombinant Human YWHAQ 293 Cell Lysate | +Inquiry |
RGS7-2369HCL | Recombinant Human RGS7 293 Cell Lysate | +Inquiry |
PEX10-3296HCL | Recombinant Human PEX10 293 Cell Lysate | +Inquiry |
SPANXN3-1543HCL | Recombinant Human SPANXN3 293 Cell Lysate | +Inquiry |
FBXL22-6311HCL | Recombinant Human FBXL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTF1 Products
Required fields are marked with *
My Review for All MTF1 Products
Required fields are marked with *
0
Inquiry Basket