Recombinant Full Length Human MTAP Protein, GST-tagged

• Cat.No.: MTAP-6481HF
• Product Overview: Human MTAP full-length ORF ( AAH26106, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 56.87 kDa
• Protein length: 283 amino acids
• AA Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTAP methylthioadenosine phosphorylase [ Homo sapiens ]
• Official Symbol: MTAP
• Synonyms: MTAP; methylthioadenosine phosphorylase; S-methyl-5-thioadenosine phosphorylase; c86fus; MSAP; MTAPase; MTA phosphorylase; MeSAdo phosphorylase; 5-methylthioadenosine phosphorylase
• Gene ID: 4507
• mRNA Refseq: NM_002451
• Protein Refseq: NP_002442
• MIM: 156540
• UniProt ID: Q13126