Recombinant Full Length Human MTAP Protein, GST-tagged
Cat.No. : | MTAP-6481HF |
Product Overview : | Human MTAP full-length ORF ( AAH26106, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 283 amino acids |
Description : | This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq |
Molecular Mass : | 56.87 kDa |
AA Sequence : | MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTAP methylthioadenosine phosphorylase [ Homo sapiens ] |
Official Symbol | MTAP |
Synonyms | MTAP; methylthioadenosine phosphorylase; S-methyl-5-thioadenosine phosphorylase; c86fus; MSAP; MTAPase; MTA phosphorylase; MeSAdo phosphorylase; 5-methylthioadenosine phosphorylase; |
Gene ID | 4507 |
mRNA Refseq | NM_002451 |
Protein Refseq | NP_002442 |
MIM | 156540 |
UniProt ID | Q13126 |
◆ Recombinant Proteins | ||
MTAP-10835Z | Recombinant Zebrafish MTAP | +Inquiry |
MTAP-386H | Recombinant Human MTAP Protein, His-tagged | +Inquiry |
MTAP-29502TH | Recombinant Human MTAP, GST-tagged | +Inquiry |
Mtap-387H | Recombinant Mouse Mtap Protein, His-tagged | +Inquiry |
MTAP-2712R | Recombinant Rhesus Macaque MTAP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTAP-424HCL | Recombinant Human MTAP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTAP Products
Required fields are marked with *
My Review for All MTAP Products
Required fields are marked with *
0
Inquiry Basket