Recombinant Full Length Human MSRA Protein, GST-tagged

• Cat.No.: MSRA-6468HF
• Product Overview: Human MSRA full-length ORF ( NP_036463.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 235 amino acids
• Description: This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 52.5 kDa
• AA Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MSRA methionine sulfoxide reductase A [ Homo sapiens ]
• Official Symbol: MSRA
• Synonyms: MSRA; methionine sulfoxide reductase A; mitochondrial peptide methionine sulfoxide reductase; peptide Met(O) reductase; peptide met (O) reductase; protein-methionine-S-oxide reductase; peptide methionine sulfoxide reductase; peptide-methionine (S)-S-oxide reductase; cytosolic methionine-S-sulfoxide reductase; PMSR
• Gene ID: 4482
• mRNA Refseq: NM_001135670
• Protein Refseq: NP_001129142
• MIM: 601250
• UniProt ID: Q9UJ68