Recombinant Full Length Human MSH2 Protein, GST-tagged

Cat.No. : MSH2-6982HF
Product Overview : Recombinant Human full-length MSH2(1 a.a. - 934 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 934 amino acids
Description : This locus is frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Two transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 131.1 kDa
AA Sequence : MAVQPKETLQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNL QSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGV KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILIT ERKKADFSTKDIYQDLNRLLKGKKGEQMNS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ]
Official Symbol MSH2
Synonyms MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1; hMSH2; FCC1; COCA1; LCFS2;
Gene ID 4436
mRNA Refseq NM_000251
Protein Refseq NP_000242
MIM 609309
UniProt ID P43246

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MSH2 Products

Required fields are marked with *

My Review for All MSH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon