Recombinant Full Length Human MS4A3 Protein, GST-tagged

• Cat.No.: MS4A3-6541HF
• Product Overview: Human MS4A3 full-length ORF ( AAH08487, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 214 amino acids
• Description: This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq
• Molecular Mass: 49.28 kDa
• AA Sequence: MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MS4A3 membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific) [ Homo sapiens ]
• Official Symbol: MS4A3
• Synonyms: MS4A3; membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific); CD20L; membrane-spanning 4-domains subfamily A member 3; HTM4; CD20 antigen homolog; IgE receptor beta chain; CD20 antigen-like protein; IgE receptor beta subunit; hematopoietic cell 4 transmembrane protein; hematopoietic-specific transmembrane protein 4
• Gene ID: 932
• mRNA Refseq: NM_001031666
• Protein Refseq: NP_001026836
• MIM: 606498
• UniProt ID: Q96HJ5