Recombinant Full Length Human MS4A2 Protein, GST-tagged

Cat.No. : MS4A2-6540HF
Product Overview : Human MS4A2 full-length ORF ( NP_000130.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 244 amino acids
Description : The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. Alternative splicing results in multiple transcript variants encoding different isoforms
Molecular Mass : 52.9 kDa
AA Sequence : MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MS4A2 membrane-spanning 4-domains, subfamily A, member 2 [ Homo sapiens ]
Official Symbol MS4A2
Synonyms MS4A2; membrane-spanning 4-domains, subfamily A, member 2; APY, FCER1B, IgE responsiveness (atopic) , IGER, membrane spanning 4 domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide); high affinity immunoglobulin epsilon receptor subunit beta; Fc fragment of IgE; high affinity I; receptor for; beta polypeptide; MS4A1; igE Fc receptor subunit beta; high affinity IgE receptor beta subunit; immunoglobulin E receptor, high affinity, beta polypeptide; Fc fragment of IgE, high affinity I, receptor for; beta polypeptide; High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fc receptor, beta-subunit) (Fc epsilon receptor I beta-chain); APY; IGEL; IGER; ATOPY; FCERI; IGHER; FCER1B;
Gene ID 2206
mRNA Refseq NM_000139
Protein Refseq NP_000130
MIM 147138
UniProt ID Q01362

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MS4A2 Products

Required fields are marked with *

My Review for All MS4A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon