Recombinant Full Length Human MS4A2 Protein, GST-tagged

• Cat.No.: MS4A2-6540HF
• Product Overview: Human MS4A2 full-length ORF ( NP_000130.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. Alternative splicing results in multiple transcript variants encoding different isoforms
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 52.9 kDa
• Protein length: 244 amino acids
• AA Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MS4A2 membrane-spanning 4-domains, subfamily A, member 2 [ Homo sapiens ]
• Official Symbol: MS4A2
• Synonyms: MS4A2; membrane-spanning 4-domains, subfamily A, member 2; APY, FCER1B, IgE responsiveness (atopic) , IGER, membrane spanning 4 domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide); high affinity immunoglobulin epsilon receptor subunit beta; Fc fragment of IgE; high affinity I; receptor for; beta polypeptide; MS4A1; igE Fc receptor subunit beta; high affinity IgE receptor beta subunit; immunoglobulin E receptor, high affinity, beta polypeptide; Fc fragment of IgE, high affinity I, receptor for; beta polypeptide; High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fc receptor, beta-subunit) (Fc epsilon receptor I beta-chain); APY; IGEL; IGER; ATOPY; FCERI; IGHER; FCER1B
• Gene ID: 2206
• mRNA Refseq: NM_000139
• Protein Refseq: NP_000130
• MIM: 147138
• UniProt ID: Q01362