Recombinant Full Length Human MRPL10 Protein, GST-tagged

• Cat.No.: MRPL10-6377HF
• Product Overview: Human MRPL10 full-length ORF ( AAH15904, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 261 amino acids
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 5q. [provided by RefSeq
• Molecular Mass: 54.45 kDa
• AA Sequence: MAAAVAGMLRGGLLPQAGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKIFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGCIDDTILSRQGFINYSKLPSLPLVQGELVGGLTCLTAQTHSPLQHQPLQLTTLLDQYIREQREKDSVMSANGKPDPDTVPDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPL10 mitochondrial ribosomal protein L10 [ Homo sapiens ]
• Official Symbol: MRPL10
• Synonyms: MRPL10; mitochondrial ribosomal protein L10; 39S ribosomal protein L10, mitochondrial; 39S ribosomal protein L10; mitochondrial; L10MT; MGC17973; MRP L8; MRP L10; MRPL8; RPML8; L8mt; 39S ribosomal protein L8, mitochondrial; MRP-L8; MRP-L10
• Gene ID: 124995
• mRNA Refseq: NM_145255
• Protein Refseq: NP_660298
• MIM: 611825
• UniProt ID: Q7Z7H8