Recombinant Full Length Human MRNIP Protein, GST-tagged

• Cat.No.: MRNIP-2674HF
• Product Overview: Human MRNIP full-length ORF (AAH69051.1, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 343 amino acids
• Description: MRNIP (MRN Complex Interacting Protein) is a Protein Coding gene.
• Molecular Mass: 64.13 kDa
• AA Sequence: MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLNLLQGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGPRFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTWKVKQGSSPCLQENSADCSAGELRGPGKELWSPIQQVTATSSKWAQFVLPPRKSSHVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPTAAVQLPRATHPVTSGSERPCGKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRNIP MRN complex interacting protein [ Homo sapiens (human) ]
• Official Symbol: MRNIP
• Synonyms: MRNIP; MRN complex interacting protein; Chromosome 5 open reading frame 45; DKFZp686L2452; LOC51149; MGC65027; MGC78537; UPF0544 protein C5orf45; C5ORF45; MRN Complex Interacting Protein; MRN-Interacting Protein; C5orf45; Chromosome 5 Open Reading Frame 45; Truncated Calcium Binding Protein; MRN Complex-Interacting Protein; UPF0544 Protein C5orf45
• Gene ID: 51149
• mRNA Refseq: NM_016175
• Protein Refseq: NP_057259
• MIM: 617154
• UniProt ID: Q6NTE8