Recombinant Full Length Human MPI Protein, GST-tagged
Cat.No. : | MPI-6323HF |
Product Overview : | Human MPI full-length ORF ( NP_002426.1, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 423 amino acids |
Description : | Phosphomannose isomerase catalyzes the interconversion of fructose-6-phosphate and mannose-6-phosphate and plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions. Mutations in the MPI gene were found in patients with carbohydrate-deficient glycoprotein syndrome, type Ib. [provided by RefSeq |
Molecular Mass : | 73.1 kDa |
AA Sequence : | MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPI mannose phosphate isomerase [ Homo sapiens ] |
Official Symbol | MPI |
Synonyms | MPI; mannose phosphate isomerase; mannose-6-phosphate isomerase; mannose 6 phosphate isomerase; phosphohexomutase; phosphomannose isomerase 1; mannose-6- phosphate isomerase; PMI; PMI1; CDG1B; FLJ39201; |
Gene ID | 4351 |
mRNA Refseq | NM_002435 |
Protein Refseq | NP_002426 |
MIM | 154550 |
UniProt ID | P34949 |
◆ Recombinant Proteins | ||
MPI-4591H | Recombinant Human MPI Protein (Ala2-Leu423), N-His tagged | +Inquiry |
MPI-703C | Recombinant Cynomolgus MPI Protein, His-tagged | +Inquiry |
MPI-301556H | Recombinant Human MPI protein, GST-tagged | +Inquiry |
MPI-3395Z | Recombinant Zebrafish MPI | +Inquiry |
MPI-6323HF | Recombinant Full Length Human MPI Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPI-4235HCL | Recombinant Human MPI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPI Products
Required fields are marked with *
My Review for All MPI Products
Required fields are marked with *
0
Inquiry Basket