Recombinant Full Length Human MORN3 Protein, GST-tagged

Cat.No. : MORN3-6312HF
Product Overview : Human MORN3 full-length ORF (AAH57760.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 240 amino acids
Description : MORN3 (MORN Repeat Containing 3) is a Protein Coding gene. An important paralog of this gene is RSPH10B2.
Molecular Mass : 52.8 kDa
AA Sequence : MPVSKCPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWEDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMFRKTEEGD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MORN3 MORN repeat containing 3 [ Homo sapiens (human) ]
Official Symbol MORN3
Synonyms MORN3; MORN repeat containing 3; MORN repeat-containing protein 3; membrane occupation and recognition nexus repeat containing protein
Gene ID 283385
mRNA Refseq NM_173855
Protein Refseq NP_776254
UniProt ID Q6PF18

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MORN3 Products

Required fields are marked with *

My Review for All MORN3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon