Recombinant Full Length Human MORN3 Protein, GST-tagged

• Cat.No.: MORN3-6312HF
• Product Overview: Human MORN3 full-length ORF (AAH57760.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 240 amino acids
• Description: MORN3 (MORN Repeat Containing 3) is a Protein Coding gene. An important paralog of this gene is RSPH10B2.
• Molecular Mass: 52.8 kDa
• AA Sequence: MPVSKCPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWEDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMFRKTEEGD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MORN3 MORN repeat containing 3 [ Homo sapiens (human) ]
• Official Symbol: MORN3
• Synonyms: MORN3; MORN repeat containing 3; MORN repeat-containing protein 3; membrane occupation and recognition nexus repeat containing protein
• Gene ID: 283385
• mRNA Refseq: NM_173855
• Protein Refseq: NP_776254
• UniProt ID: Q6PF18