Recombinant Human MORN3 Protein, GST-tagged
Cat.No. : | MORN3-5482H |
Product Overview : | Human MORN3 full-length ORF (AAH57760.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MORN3 (MORN Repeat Containing 3) is a Protein Coding gene. An important paralog of this gene is RSPH10B2. |
Molecular Mass : | 52.8 kDa |
AA Sequence : | MPVSKCPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWEDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMFRKTEEGD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MORN3 MORN repeat containing 3 [ Homo sapiens (human) ] |
Official Symbol | MORN3 |
Synonyms | MORN3; MORN repeat containing 3; MORN repeat-containing protein 3; membrane occupation and recognition nexus repeat containing protein |
Gene ID | 283385 |
mRNA Refseq | NM_173855 |
Protein Refseq | NP_776254 |
UniProt ID | Q6PF18 |
◆ Recombinant Proteins | ||
MORN3-1634H | Recombinant Human MORN3 | +Inquiry |
MORN3-701C | Recombinant Cynomolgus MORN3 Protein, His-tagged | +Inquiry |
Morn3-4117M | Recombinant Mouse Morn3 Protein, Myc/DDK-tagged | +Inquiry |
MORN3-3495H | Recombinant Human MORN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MORN3-447C | Recombinant Cynomolgus Monkey MORN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MORN3-4250HCL | Recombinant Human MORN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MORN3 Products
Required fields are marked with *
My Review for All MORN3 Products
Required fields are marked with *
0
Inquiry Basket