Recombinant Full Length Human MLF1IP Protein, GST-tagged

Cat.No. : MLF1IP-6351HF
Product Overview : Human MLF1IP full-length ORF ( AAH31520, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 176 amino acids
Description : The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). MLF1IP, or CENPU, is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).[supplied by OMIM
Molecular Mass : 45.1 kDa
AA Sequence : MKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MLF1IP MLF1 interacting protein [ Homo sapiens ]
Official Symbol MLF1IP
Synonyms CENPU; KLIP1; PBIP1; CENP50; CENPU50
Gene ID 79682
mRNA Refseq NM_024629
Protein Refseq NP_078905
MIM 611511
UniProt ID Q71F23

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MLF1IP Products

Required fields are marked with *

My Review for All MLF1IP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon