Recombinant Human MLF1IP Protein, GST-tagged

• Cat.No.: MLF1IP-5383H
• Product Overview: Human MLF1IP full-length ORF ( AAH31520, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). MLF1IP, or CENPU, is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).[supplied by OMIM
• Molecular Mass: 45.1 kDa
• AA Sequence: MKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MLF1IP MLF1 interacting protein [ Homo sapiens ]
• Official Symbol: MLF1IP
• Synonyms: CENPU; KLIP1; PBIP1; CENP50; CENPU50
• Gene ID: 79682
• mRNA Refseq: NM_024629
• Protein Refseq: NP_078905
• MIM: 611511
• UniProt ID: Q71F23