Recombinant Full Length Human MIER1 Protein, GST-tagged

• Cat.No.: MIER1-6592HF
• Product Overview: Human MIER1 full-length ORF ( AAH17423.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 156 amino acids
• Description: This gene encodes a protein that was first identified in Xenopus laevis by its role in a mesoderm induction early response (MIER). The encoded protein functions as a transcriptional regulator. Alternatively spliced transcript variants encode multiple isoforms, some of which lack a C-terminal nuclear localization signal. [provided by RefSeq, May 2013]
• Molecular Mass: 44.2 kDa
• AA Sequence: MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MIER1 mesoderm induction early response 1 homolog (Xenopus laevis) [ Homo sapiens ]
• Official Symbol: MIER1
• Synonyms: MIER1; mesoderm induction early response 1 homolog (Xenopus laevis); mesoderm induction early response protein 1; hMI ER1; KIAA1610; MI ER1; ER1; MI-ER1; hMI-ER1; RP5-944N15.1; MGC131940; MGC150640; MGC150641; DKFZp781G0451
• Gene ID: 57708
• mRNA Refseq: NM_001077700
• Protein Refseq: NP_001071168
• MIM: 616848
• UniProt ID: Q8N108