Recombinant Full Length Human MIA Protein, GST-tagged

• Cat.No.: MIA-6549HF
• Product Overview: Human MIA full-length ORF ( AAH05910, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: MIA (Melanoma Inhibitory Activity) is a Protein Coding gene. Diseases associated with MIA include Melanoma and Skin Melanoma. Among its related pathways are Neural Crest Differentiation. GO annotations related to this gene include growth factor activity. An important paralog of this gene is MIA-RAB4B.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 40.15 kDa
• Protein length: 131 amino acids
• AA Sequence: MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MIA melanoma inhibitory activity [ Homo sapiens ]
• Official Symbol: MIA
• Synonyms: MIA; melanoma inhibitory activity; melanoma-derived growth regulatory protein; CD RAP; CD-RAP
• Gene ID: 8190
• mRNA Refseq: NM_001202553
• Protein Refseq: NP_001189482
• MIM: 601340
• UniProt ID: Q16674