Recombinant Human MIA
Cat.No. : | MIA-7961H |
Product Overview : | Recombinant Human Melanoma Inhibitory Activity Protein/MIA is produced with our E. coli expression system. The target protein is expressed with sequence (Gly25-Gln131) of Human MIA. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 25-131 a.a. |
Description : | Melanoma Inhibitory Activity Protein (MIA) is an autocrine growth regulatory protein secreted from chondrocytes and malignant melanoma cells, which was the first discovered member of a family of secreted cytokines termed the MIA/OTOR family. The four known members of this family: MIA, MIA2, OTOR and TANGO each contain a Src homology-3 (SH3)-like domain. MIA acts as a potent tumor cell growth inhibitor for malignant melanoma cells and some other neuroectodermal tumors, including gliomas, in an autocrine fashion and promotes melanoma metastasis by binding competitively to fibronectin and laminin in a manner that results in melanoma cell detachment from the extracellular matrix in vivo. The protein MIA has been shown to represent a very sensitive and specific serum marker for systemic malignant melanoma that might be useful for staging of primary melanomas, detection of progression from localized to metastatic disease during follow-up, and monitoring therapy of advanced melanomas. Elevated levels of MIA may represent a clinically useful marker for diagnosis of melanoma metastasis as well as a potential marker for rheumatoid arthritis. |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
AA Sequence : | MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSV QGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQLEHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Publications : |
Melanoma Inhibitory Activity (MIA) Is Able to Induce Vitiligo-Like Depigmentation in an in vivo Mouse Model by Direct Injection in the Tail (2020)
|
Gene Name | MIA melanoma inhibitory activity [ Homo sapiens (human) ] |
Official Symbol | MIA |
Synonyms | MIA; melanoma inhibitory activity; CD-RAP; melanoma-derived growth regulatory protein |
Gene ID | 8190 |
mRNA Refseq | NM_006533 |
Protein Refseq | NP_006524 |
MIM | 601340 |
UniProt ID | Q16674 |
Chromosome Location | 19q13.2 |
Pathway | Neural Crest Differentiation |
Function | growth factor activity |
◆ Recombinant Proteins | ||
MIA-2768R | Recombinant Rhesus monkey MIA Protein, His-tagged | +Inquiry |
Mia-1543R | Recombinant Rat Mia protein, His & GST-tagged | +Inquiry |
MIA-140H | Recombinant Human MIA protein | +Inquiry |
MIA-3604H | Recombinant Human MIA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MIA-3677R | Recombinant Rat MIA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIA-4325HCL | Recombinant Human MIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIA Products
Required fields are marked with *
My Review for All MIA Products
Required fields are marked with *
0
Inquiry Basket