Recombinant Human MIA protein

• Cat.No.: MIA-140H
• Product Overview: Recombinant Human MIA protein was expressed in Escherichia coli.

Specification

• Source: E.coli
• Species: Human
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 5 % Trehalose.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human A375 cell line is less than 5 μg/ml, corresponding to a specific activity of > 200 IU/mg.
• Molecular Mass: Approximately 12.1 kDa, a single non-glycosylated polypeptide chain containing 107 amino acids.
• Protein length: 107
• AA Sequence: GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
• Endotoxin: Less than 0.1 EU/µg of rHuMIA as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: MIA
• Official Symbol: MIA
• Synonyms: MIA; melanoma inhibitory activity; melanoma-derived growth regulatory protein; CD RAP; CD-RAP
• Gene ID: 8190
• mRNA Refseq: NM_001202553
• Protein Refseq: NP_001189482
• MIM: 601340
• UniProt ID: Q16674