Recombinant Full Length Human MFNG Protein, GST-tagged
Cat.No. : | MFNG-6198HF |
Product Overview : | Human MFNG full-length ORF ( NP_002396.2, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 321 amino acids |
Description : | This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. [provided by RefSeq |
Molecular Mass : | 62.6 kDa |
AA Sequence : | MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MFNG MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase [ Homo sapiens ] |
Official Symbol | MFNG |
Synonyms | MFNG; MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; manic fringe (Drosophila) homolog , manic fringe homolog (Drosophila); beta-1,3-N-acetylglucosaminyltransferase manic fringe; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; |
Gene ID | 4242 |
mRNA Refseq | NM_001166343 |
Protein Refseq | NP_001159815 |
MIM | 602577 |
UniProt ID | O00587 |
◆ Recombinant Proteins | ||
MFNG-6198HF | Recombinant Full Length Human MFNG Protein, GST-tagged | +Inquiry |
RFL4411HF | Recombinant Full Length Human Beta-1,3-N-Acetylglucosaminyltransferase Manic Fringe(Mfng) Protein, His-Tagged | +Inquiry |
MFNG-4379H | Recombinant Human MFNG Protein, GST-tagged | +Inquiry |
MFNG-1862Z | Recombinant Zebrafish MFNG | +Inquiry |
MFNG-1880H | Recombinant Human MFNG protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFNG-4346HCL | Recombinant Human MFNG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MFNG Products
Required fields are marked with *
My Review for All MFNG Products
Required fields are marked with *
0
Inquiry Basket