Recombinant Full Length Human MEN1 Protein, C-Flag-tagged
Cat.No. : | MEN1-229HFL |
Product Overview : | Recombinant Full Length Human MEN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes menin, a tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. Menin is a scaffold protein that functions in histone modification and epigenetic gene regulation. It is thought to regulate several pathways and processes by altering chromatin structure through the modification of histones. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.3 kDa |
AA Sequence : | MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPD PPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHI QSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQT VNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMAL GNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQD YNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLRFYDGI CKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPE EPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAASPPPEGPVLTFQSEKMKG MKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | MEN1 menin 1 [ Homo sapiens (human) ] |
Official Symbol | MEN1 |
Synonyms | MEAI; SCG2 |
Gene ID | 4221 |
mRNA Refseq | NM_130799.3 |
Protein Refseq | NP_570711.2 |
MIM | 613733 |
UniProt ID | O00255 |
◆ Recombinant Proteins | ||
MEN1-3302R | Recombinant Rat MEN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEN1-0457H | Recombinant Human MEN1 Protein (M1-L615), Tag Free | +Inquiry |
MEN1-8591Z | Recombinant Zebrafish MEN1 | +Inquiry |
MEN1-303HF | Recombinant Full Length Human MEN1 Protein | +Inquiry |
MEN1-6132HF | Recombinant Full Length Human MEN1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MEN1-5475MB | Recombinant Full Length Mouse MEN1 Protein, His&Avi tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEN1-1077HCL | Recombinant Human MEN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEN1 Products
Required fields are marked with *
My Review for All MEN1 Products
Required fields are marked with *
0
Inquiry Basket