Recombinant Full Length Human MEF2C Protein, C-Flag-tagged
Cat.No. : | MEF2C-671HFL |
Product Overview : | Recombinant Full Length Human MEF2C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe cognitive disability, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51 kDa |
AA Sequence : | MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYT EYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPN FEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGT SAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQ RINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW QQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWATTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | MAPK signaling pathway |
Full Length : | Full L. |
Gene Name | MEF2C myocyte enhancer factor 2C [ Homo sapiens (human) ] |
Official Symbol | MEF2C |
Synonyms | NEDHSIL; DEL5q14.3; C5DELq14.3 |
Gene ID | 4208 |
mRNA Refseq | NM_002397.5 |
Protein Refseq | NP_002388.2 |
MIM | 600662 |
UniProt ID | Q06413 |
◆ Recombinant Proteins | ||
MEF2C-310HF | Recombinant Full Length Human MEF2C Protein | +Inquiry |
Mef2c-4026M | Recombinant Mouse Mef2c Protein, Myc/DDK-tagged | +Inquiry |
MEF2C-2550R | Recombinant Rhesus Macaque MEF2C Protein, His (Fc)-Avi-tagged | +Inquiry |
MEF2C-4455H | Recombinant Human MEF2C Protein, GST-tagged | +Inquiry |
MEF2C-671HFL | Recombinant Full Length Human MEF2C Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEF2C-4375HCL | Recombinant Human MEF2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEF2C Products
Required fields are marked with *
My Review for All MEF2C Products
Required fields are marked with *
0
Inquiry Basket