Recombinant Full Length Human MED27 Protein, GST-tagged
Cat.No. : | MED27-2109HF |
Product Overview : | Human CRSP8 full-length ORF ( AAH02878, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 70 amino acids |
Description : | The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 33.44 kDa |
AA Sequence : | MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MED27 mediator complex subunit 27 [ Homo sapiens ] |
Official Symbol | MED27 |
Synonyms | MED27; mediator complex subunit 27; cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa , CRSP8; mediator of RNA polymerase II transcription subunit 27; CRSP34; TRAP37; CRSP complex subunit 8; p37 TRAP/SMCC/PC2 subunit; transcriptional coactivator CRSP34; cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa; CRSP8; CRAP34; FLJ42238; MGC11274 |
Gene ID | 9442 |
mRNA Refseq | NM_001253881 |
Protein Refseq | NP_001240810 |
MIM | 605044 |
UniProt ID | Q6P2C8 |
◆ Recombinant Proteins | ||
MED27-2109HF | Recombinant Full Length Human MED27 Protein, GST-tagged | +Inquiry |
MED27-9699M | Recombinant Mouse MED27 Protein | +Inquiry |
MED27-5455M | Recombinant Mouse MED27 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED27-1909H | Recombinant Human MED27 Protein, GST-tagged | +Inquiry |
MED27-4755C | Recombinant Chicken MED27 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED27-4385HCL | Recombinant Human MED27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MED27 Products
Required fields are marked with *
My Review for All MED27 Products
Required fields are marked with *
0
Inquiry Basket