Recombinant Full Length Human MED19 Protein, GST-tagged

• Cat.No.: MED19-6213HF
• Product Overview: Human MED19 full-length ORF ( NP_703151.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 194 amino acids
• Description: MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).[supplied by OMIM
• Molecular Mass: 46.8 kDa
• AA Sequence: MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MED19 mediator complex subunit 19 [ Homo sapiens ]
• Official Symbol: MED19
• Synonyms: MED19; mediator complex subunit 19; mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 19; LCMR1; lung cancer metastasis-related protein 1; mediator of RNA polymerase II transcription, subunit 19 homolog; DT2P1G7
• Gene ID: 219541
• mRNA Refseq: NM_153450
• Protein Refseq: NP_703151
• MIM: 612385
• UniProt ID: A0JLT2