Recombinant Full Length Human LTBR Protein, GST-tagged

• Cat.No.: LTBR-6208HF
• Product Overview: Human LTBR full-length ORF ( AAH26262, 31 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the tumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cells of epithelial and myeloid lineages, but not on T and B lymphocytes. The protein specifically binds the lymphotoxin membrane form (a complex of lymphotoxin-alpha and lymphtoxin-beta). The encoded protein and its ligand play a role in the development and organization of lymphoid tissue and tranformed cells. Activation of the encoded protein can trigger apoptosis. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 70.29 kDa
• Protein length: 31-435 amino acids
• AA Sequence: QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LTBR lymphotoxin beta receptor (TNFR superfamily, member 3) [ Homo sapiens ]
• Official Symbol: LTBR
• Synonyms: LTBR; lymphotoxin beta receptor (TNFR superfamily, member 3); D12S370; tumor necrosis factor receptor superfamily member 3; TNF R III; TNFCR; TNFR RP; TNFR2 RP; TNFRSF3; TNF-RIII; TNFR-III; lymphotoxin B receptor; lymphotoxin-beta receptor; TNFR superfamily, member 3; tumor necrosis factor C receptor; tumor necrosis factor receptor type III; tumor necrosis factor receptor 2-related protein; tumor necrosis factor receptor superfamily, member 3; CD18; TNFR-RP; TNFR2-RP; LT-BETA-R; TNF-R-III
• Gene ID: 4055
• mRNA Refseq: NM_002342
• Protein Refseq: NP_002333
• MIM: 600979
• UniProt ID: P36941