Recombinant Full Length Human LTBR Protein, GST-tagged

Cat.No. : LTBR-6208HF
Product Overview : Human LTBR full-length ORF ( AAH26262, 31 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 31-435 amino acids
Description : The protein encoded by this gene is a member of the tumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cells of epithelial and myeloid lineages, but not on T and B lymphocytes. The protein specifically binds the lymphotoxin membrane form (a complex of lymphotoxin-alpha and lymphtoxin-beta). The encoded protein and its ligand play a role in the development and organization of lymphoid tissue and tranformed cells. Activation of the encoded protein can trigger apoptosis. [provided by RefSeq
Molecular Mass : 70.29 kDa
AA Sequence : QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LTBR lymphotoxin beta receptor (TNFR superfamily, member 3) [ Homo sapiens ]
Official Symbol LTBR
Synonyms LTBR; lymphotoxin beta receptor (TNFR superfamily, member 3); D12S370; tumor necrosis factor receptor superfamily member 3; TNF R III; TNFCR; TNFR RP; TNFR2 RP; TNFRSF3; TNF-RIII; TNFR-III; lymphotoxin B receptor; lymphotoxin-beta receptor; TNFR superfamily, member 3; tumor necrosis factor C receptor; tumor necrosis factor receptor type III; tumor necrosis factor receptor 2-related protein; tumor necrosis factor receptor superfamily, member 3; CD18; TNFR-RP; TNFR2-RP; LT-BETA-R; TNF-R-III;
Gene ID 4055
mRNA Refseq NM_002342
Protein Refseq NP_002333
MIM 600979
UniProt ID P36941

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LTBR Products

Required fields are marked with *

My Review for All LTBR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon