Recombinant Full Length Human LSM1 Protein, GST-tagged

Cat.No. : LSM1-6121HF
Product Overview : Human LSM1 full-length ORF ( AAH01767, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 133 amino acids
Description : Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
Molecular Mass : 40.37 kDa
AA Sequence : MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LSM1 LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ]
Official Symbol LSM1
Synonyms LSM1; LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm1; CASM; YJL124C; small nuclear ribonuclear CaSm; cancer-associated Sm-like protein;
Gene ID 27257
mRNA Refseq NM_014462
Protein Refseq NP_055277
MIM 607281
UniProt ID O15116

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LSM1 Products

Required fields are marked with *

My Review for All LSM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon