Recombinant Full Length Human LRG1 Protein, GST-tagged

• Cat.No.: LRG1-6007HF
• Product Overview: Human LRG1 full-length ORF ( AAH34389, 37 a.a. - 347 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Product Overview: Human LRG1 full-length ORF ( AAH34389, 37 a.a. - 347 a.a.) recombinant protein with GST-tag at N-terminal.
• Description: The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (ODonnell et al., 2002 [PubMed 12223515]).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 59.95 kDa
• Protein length: 37-347 amino acids
• AA Sequence: TLSPKDCQVFRPDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQRDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRG1 leucine-rich alpha-2-glycoprotein 1 [ Homo sapiens ]
• Official Symbol: LRG1
• Synonyms: LRG1; leucine-rich alpha-2-glycoprotein 1; leucine-rich alpha-2-glycoprotein; leucine rich alpha 2 glycoprotein; LRG; 1300008B03Rik; 2310031E04Rik; HMFT1766; FLJ45787
• Gene ID: 116844
• mRNA Refseq: NM_052972
• Protein Refseq: NP_443204
• MIM: 611289
• UniProt ID: P02750