Recombinant Human LRG1 protein, T7/His-tagged
Cat.No. : | LRG1-54H |
Product Overview : | Recombinant human LRG1 cDNA (36 – 347 aa, derived from BC034389) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 36-347 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLT HLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLE VSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDL LLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQN LSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro LRG1 protein mediated cell adhesion pathway regulation study for various cancer cell growth controlling with this protein as either coating matrix protein or soluble factor.2. May be used as LRG1 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. Potential biomarker protein for various cancer diseases.5. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | LRG1 leucine-rich alpha-2-glycoprotein 1 [ Homo sapiens ] |
Official Symbol | LRG1 |
Synonyms | LRG1; leucine-rich alpha-2-glycoprotein 1; leucine-rich alpha-2-glycoprotein; leucine rich alpha 2 glycoprotein; LRG; 1300008B03Rik; 2310031E04Rik; HMFT1766; FLJ45787; |
Gene ID | 116844 |
mRNA Refseq | NM_052972 |
Protein Refseq | NP_443204 |
MIM | 611289 |
UniProt ID | P02750 |
Chromosome Location | 19 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
LRG1-4001H | Recombinant Human LRG1 Protein (Thr37-Leu340), N-His tagged | +Inquiry |
LRG1-297HFL | Recombinant Full Length Human LRG1 Protein, C-Flag-tagged | +Inquiry |
LRG1-1315H | Recombinant Human LRG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRG1-854H | Recombinant Human LRG1 Protein, MYC/DDK-tagged | +Inquiry |
Lrg1-1987R | Recombinant Rat Lrg1 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
LRG1-3684H | Native Human LRG1 | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRG1-791HCL | Recombinant Human LRG1 cell lysate | +Inquiry |
LRG1-755HCL | Recombinant Human LRG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRG1 Products
Required fields are marked with *
My Review for All LRG1 Products
Required fields are marked with *
0
Inquiry Basket