Recombinant Full Length Human LPHN1 Protein

• Cat.No.: LPHN1-5988HF
• Product Overview: Human LPHN1 full-length ORF (AAH19928.1) recombinant protein without tag.

Specification

• Description: This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 20.8 kDa
• Protein length: 343 amino acids
• AA Sequence: MGLISHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: LPHN1 latrophilin 1 [ Homo sapiens ]
• Official Symbol: LPHN1
• Synonyms: LPHN1; latrophilin 1; latrophilin-1; CIRL1; KIAA0821; LEC2; CIRL-1; lectomedin-2; calcium-independent alpha-latrotoxin receptor 1; CL1
• Gene ID: 22859
• mRNA Refseq: NM_001008701
• Protein Refseq: NP_001008701
• MIM: 616416
• UniProt ID: O94910