Recombinant Full Length Human LINC02145 Protein, GST-tagged

• Cat.No.: LINC02145-5015HF
• Product Overview: Human FLJ33360 full-length ORF ( ADR83476.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LINC02145 (Long Intergenic Non-Protein Coding RNA 2145) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 14.3 kDa
• Protein length: 130 amino acids
• AA Sequence: MDGTCIERRRQWYRDDLPLCFKKEENPPSNNVDGPGGCYAKCKKKREGQMLHDLIPMGPATATSFLTEDIGLAFYQVSPLLGFLCLLSQDTWNMYTCPRWIGRSAEPPSAACQAGGTRLLGTLHSPALLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LINC02145 long intergenic non-protein coding RNA 2145 [ Homo sapiens (human) ]
• Official Symbol: LINC02145
• Synonyms: LINC02145; long intergenic non-protein coding RNA 2145; CTD-2324F15.2
• Gene ID: 401172