Recombinant Full Length Human LINC02145 Protein, GST-tagged
Cat.No. : | LINC02145-5015HF |
Product Overview : | Human FLJ33360 full-length ORF ( ADR83476.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | LINC02145 (Long Intergenic Non-Protein Coding RNA 2145) is an RNA Gene, and is affiliated with the non-coding RNA class. |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 14.3 kDa |
Protein length : | 130 amino acids |
AA Sequence : | MDGTCIERRRQWYRDDLPLCFKKEENPPSNNVDGPGGCYAKCKKKREGQMLHDLIPMGPATATSFLTEDIGLAFYQVSPLLGFLCLLSQDTWNMYTCPRWIGRSAEPPSAACQAGGTRLLGTLHSPALLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LINC02145 long intergenic non-protein coding RNA 2145 [ Homo sapiens (human) ] |
Official Symbol | LINC02145 |
Synonyms | LINC02145; long intergenic non-protein coding RNA 2145; CTD-2324F15.2 |
Gene ID | 401172 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LINC02145 Products
Required fields are marked with *
My Review for All LINC02145 Products
Required fields are marked with *
0
Inquiry Basket