Recombinant Full Length Human Leukotriene-B(4) Omega-Hydroxylase 2(Cyp4F3) Protein, His-Tagged
Cat.No. : | RFL23570HF |
Product Overview : | Recombinant Full Length Human Leukotriene-B(4) omega-hydroxylase 2(CYP4F3) Protein (Q08477) (1-520aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-520) |
Form : | Lyophilized powder |
AA Sequence : | MPQLSLSSLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWF LGHLGLIHSSEEGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPK DKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL LASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVTKRHQQIL LYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE LLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIIC LISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV VLGLTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP4F3 |
Synonyms | CYP4F3; LTB4H; Cytochrome P450 4F3; 20-hydroxyeicosatetraenoic acid synthase; 20-HETE synthase; CYPIVF3; Cytochrome P450-LTB-omega; Docosahexaenoic acid omega-hydroxylase CYP4F3; Leukotriene-B(4 20-monooxygenase 2; Leukotriene-B(4 omega-hydroxylase 2 |
UniProt ID | Q08477 |
◆ Recombinant Proteins | ||
CYP4F3-86H | Active Recombinant Human CYP4F3 Protein | +Inquiry |
CYP4F3-2285H | Recombinant Human CYP4F3 Protein, GST-tagged | +Inquiry |
RFL23570HF | Recombinant Full Length Human Leukotriene-B(4) Omega-Hydroxylase 2(Cyp4F3) Protein, His-Tagged | +Inquiry |
RFL23043RF | Recombinant Full Length Rat Leukotriene-B(4) Omega-Hydroxylase 2(Cyp4F3) Protein, His-Tagged | +Inquiry |
CYP4F3-28191TH | Recombinant Human CYP4F3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP4F3 Products
Required fields are marked with *
My Review for All CYP4F3 Products
Required fields are marked with *
0
Inquiry Basket