Recombinant Human CYP4F3

• Cat.No.: CYP4F3-28191TH
• Product Overview: Recombinant fragment of Human CYP4F3 with N terminal proprietary tag. Predicted MW 36.52 kDa.

Specification

• Description: This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F8, is approximately 18 kb away. Three transcript variants encoding two different isoforms have been found for this gene.
• Protein length: 99 amino acids
• Molecular Weight: 36.520kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in the polymorphonuclear leukocytes as well as leukocytes.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
• Sequence Similarities: Belongs to the cytochrome P450 family.
• Tag: Non

Gene Information

• Gene Name: CYP4F3 cytochrome P450, family 4, subfamily F, polypeptide 3 [ Homo sapiens ]
• Official Symbol: CYP4F3
• Synonyms: CYP4F3; cytochrome P450, family 4, subfamily F, polypeptide 3; cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase) , LTB4H; leukotriene-B(4) omega-hydroxylase 2; CYP4F
• Gene ID: 4051
• mRNA Refseq: NM_000896
• Protein Refseq: NP_000887
• MIM: 601270
• Uniprot ID: Q08477
• Chromosome Location: 19p13.2
• Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem; Eicosanoids, organism-specific biosystem
• Function: electron carrier activity; heme binding; leukotriene-B4 20-monooxygenase activity; metal ion binding; monooxygenase activity