Recombinant Full Length Human LAIR2 Protein

• Cat.No.: LAIR2-273HF
• Product Overview: Recombinant full length Human LAIR2 with N terminal proprietary tag; Predicted MW 42.79 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 152 amino acids
• Description: The protein encoded by this gene is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene.
• Form: Liquid
• Molecular Mass: 42.790kDa inclusive of tags
• AA Sequence: MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVIS PGSHVTFMCRGPVGVQTFRLEREDRAKYKDSYNVFRLGPS ESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLV KESSGGPDSPDTEPGSSAGTVPGTEASGFDAP
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: LAIR2 leukocyte-associated immunoglobulin-like receptor 2 [ Homo sapiens ]
• Official Symbol: LAIR2
• Synonyms: LAIR2; leukocyte-associated immunoglobulin-like receptor 2; leukocyte associated Ig like receptor 2; CD306
• Gene ID: 3904
• mRNA Refseq: NM_002288
• Protein Refseq: NP_002279
• MIM: 602993
• UniProt ID: Q6ISS4