Recombinant Full Length Human KRT9 Protein, GST-tagged

• Cat.No.: KRT9-5791HF
• Product Overview: Human KRT9 full-length ORF (AAI67813.1, 1 a.a. - 623 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Description: This gene encodes the type I keratin 9, an intermediate filament chain expressed only in the terminally differentiated epidermis of palms and soles. Mutations in this gene cause epidermolytic palmoplantar keratoderma. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 95 kDa
• Protein length: 623 amino acids
• AA Sequence: MSCRQFSSSYLSRSGGGGGGGLGSGGSIRSSYSRFSSSGGGGGGGRFSSSSGYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGFGGFGGGAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEANNDLENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFRIKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEIECQNQEYSLLLSIKMRLEKEIETYHNLLEGGQEDFESSGAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGKSSHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRT9 keratin 9 [ Homo sapiens ]
• Official Symbol: KRT9
• Synonyms: KRT9; keratin 9; keratin, type I cytoskeletal 9; CK 9; cytokeratin 9; epidermolytic palmoplantar keratoderma; EPPK; K9; type I cytoskeletal 9; keratin-9; cytokeratin-9; CK-9
• Gene ID: 3857
• mRNA Refseq: NM_000226
• Protein Refseq: NP_000217
• MIM: 607606
• UniProt ID: P35527