Recombinant Full Length Human JUND Protein, C-Flag-tagged
Cat.No. : | JUND-1533HFL |
Product Overview : | Recombinant Full Length Human JUND Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35 kDa |
AA Sequence : | METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPP TPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGF VKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGA ATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRI AASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | MAPK signaling pathway |
Full Length : | Full L. |
Gene Name | JUND JunD proto-oncogene, AP-1 transcription factor subunit [ Homo sapiens (human) ] |
Official Symbol | JUND |
Synonyms | AP-1 |
Gene ID | 3727 |
mRNA Refseq | NM_005354.6 |
Protein Refseq | NP_005345.3 |
MIM | 165162 |
UniProt ID | P17535 |
◆ Recombinant Proteins | ||
Jund-1254M | Recombinant Mouse Jund Protein, MYC/DDK-tagged | +Inquiry |
JUND-2804R | Recombinant Rat JUND Protein, His (Fc)-Avi-tagged | +Inquiry |
JUND-4695M | Recombinant Mouse JUND Protein, His (Fc)-Avi-tagged | +Inquiry |
JUND-240H | Recombinant Human JUND Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
JUND-1533HFL | Recombinant Full Length Human JUND Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JUND Products
Required fields are marked with *
My Review for All JUND Products
Required fields are marked with *
0
Inquiry Basket