Recombinant Full Length Human JCHAIN Protein, GST-tagged

• Cat.No.: JCHAIN-6953HF
• Product Overview: Recombinant Human full-length JCHAIN(1 a.a. - 159 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 159 amino acids
• Description: JCHAIN played an important role in many functions.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.23 kDa
• AA Sequence: MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRENISDP TSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVET ALTPDACYPD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: JCHAIN joining chain of multimeric IgA and IgM [ Homo sapiens ]
• Official Symbol: JCHAIN
• Synonyms: IGJ; immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides; immunoglobulin J chain; IGCJ; IgJ chain; JCH
• Gene ID: 3512
• mRNA Refseq: NM_144646
• Protein Refseq: NP_653247
• MIM: 147790
• UniProt ID: P01591