Recombinant Active Pig IL2 Protein, His-tagged(C-ter)
Cat.No. : | IL2-171P |
Product Overview : | Recombinant Active Pig IL2 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a secreted cytokine that is important for the proliferation of T and B lymphocytes. The receptor of this cytokine is a heterotrimeric protein complex whose gamma chain is also shared by interleukin 4 (IL4) and interleukin 7 (IL7). The expression of this gene in mature thymocytes is monoallelic, which represents an unusual regulatory mode for controlling the precise expression of a single gene. The targeted disruption of a similar gene in mice leads to ulcerative colitis-like disease, which suggests an essential role of this gene in the immune response to antigenic stimuli. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce proliferation in CTLL2 cells. The ED50 for this effect is < 0.5 ng/mL. |
AA Sequence : | MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL2 interleukin 2 [ Sus scrofa ] |
Official Symbol | IL2 |
Synonyms | IL2; interleukin 2; interleukin-2; T-cell growth factor; IL-2; TCGF; POIL2; |
Gene ID | 396868 |
mRNA Refseq | NM_213861 |
Protein Refseq | NP_999026 |
◆ Recombinant Proteins | ||
IL2-5446H | Recombinant Human IL2 protein, His-tagged | +Inquiry |
IL2-464H | Active Recombinant Human Interleukin 2 | +Inquiry |
IL2-590C | Recombinant Chicken IL2 | +Inquiry |
IL2-29H | Active Recombinant Human IL2 protein | +Inquiry |
IL2-672E | Active Recombinant Equine IL2, Met-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *
0
Inquiry Basket