Recombinant Full Length Human ITM2B Protein, GST-tagged

• Cat.No.: ITM2B-5823HF
• Product Overview: Human ITM2B full-length ORF ( NP_068839.1, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 266 amino acids
• Description: Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by furin or furin-like proteases to produce a small secreted peptide which inhibits the deposition of beta-amyloid. Mutations which result in extension of the C-terminal end of the encoded protein, thereby increasing the size of the secreted peptide, are associated with two neurogenerative diseases, familial British dementia and familial Danish dementia. [provided by RefSeq, Oct 2009]
• Molecular Mass: 56.7 kDa
• AA Sequence: MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITM2B integral membrane protein 2B [ Homo sapiens ]
• Official Symbol: ITM2B
• Synonyms: ITM2B; integral membrane protein 2B; BRI; E3 16; E25B; ABri/ADan amyloid peptide; transmembrane protein BRI; BRICHOS domain containing 2B; FBD; ABRI; BRI2; E3-16; BRICD2B
• Gene ID: 9445
• mRNA Refseq: NM_021999
• Protein Refseq: NP_068839
• MIM: 603904
• UniProt ID: Q9Y287