Recombinant Human ITM2B, His-tagged

• Cat.No.: ITM2B-120H
• Product Overview: Recombinant Human Integral Membrane Protein 2B/ITM2B is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Tyr76-Ser266) of Human ITM2B fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 76-266 a.a.
• Description: Integral Membrane Protein 2B (ITM2B) is expressed in the Golgi and on the cell surface. ITM2B forms homodimer through disulfide-linked interaction with SPPL2A, SPPL2B and APP. ITM2B is expressed in brain and the other tissues. Defects in ITM2B cause cerebral amyloid angiopathy ITM2B-related type 1(CAA-ITM2B1) and amyloid angiopathy ITM2B-related type 2(CAA-ITM2B2). CAA-ITM2B1 is characterized by amyloid deposition in the walls of cerebral blood vessels and neurodegeneration in the central nervous system. CAA-ITM2B2 characterized by amyloid deposition in the walls of the blood vessels of the cerebrum, choroid plexus, cerebellum, spinal cord and retina.
• AA Sequence: YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADS DPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVI TDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICSVDHH HHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: ITM2B integral membrane protein 2B [ Homo sapiens ]
• Official Symbol: ITM2B
• Synonyms: ITM2B; integral membrane protein 2B; BRI; E3 16; E25B; ABri/ADan amyloid peptide; transmembrane protein BRI; BRICHOS domain containing 2B; FBD; ABRI; BRI2; E3-16; BRICD2B
• Gene ID: 9445
• mRNA Refseq: NM_021999
• Protein Refseq: NP_068839
• MIM: 603904
• UniProt ID: Q9Y287
• Chromosome Location: 13q14.2
• Pathway: Amyloids, organism-specific biosystem; Disease, organism-specific biosystem; IL-2 Signaling Pathway, organism-specific biosystem
• Function: ATP binding; beta-amyloid binding