Recombinant Full Length Human ITGB1BP1 Protein, GST-tagged

Cat.No. : ITGB1BP1-5761HF
Product Overview : Human ITGB1BP1 full-length ORF ( AAH12264, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 200 amino acids
Description : The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion. [provided by RefSeq
Molecular Mass : 47.74 kDa
AA Sequence : MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITGB1BP1 integrin beta 1 binding protein 1 [ Homo sapiens ]
Official Symbol ITGB1BP1
Synonyms ITGB1BP1; integrin beta 1 binding protein 1; integrin beta-1-binding protein 1; bodenin; ICAP 1A; ICAP 1alpha; ICAP 1B; ICAP1; ICAP1A; ICAP1B; integrin cytoplasmic domain associated protein 1; integrin cytoplasmic domain associated protein 1 alpha; integrin cytoplasmic domain associated protein 1 beta; ICAP-1; integrin cytoplasmic domain-associated protein 1; integrin cytoplasmic domain-associated protein 1-beta; integrin cytoplasmic domain-associated protein 1-alpha; ICAP-1A; ICAP-1B; ICAP-1alpha; DKFZp686K08158;
Gene ID 9270
mRNA Refseq NM_004763
Protein Refseq NP_004754
MIM 607153
UniProt ID O14713

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ITGB1BP1 Products

Required fields are marked with *

My Review for All ITGB1BP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon