Recombinant Full Length Human ISCA1 Protein, GST-tagged

• Cat.No.: ISCA1-3497HF
• Product Overview: Human HBLD2 full-length ORF ( AAH02675, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 129 amino acids
• Description: ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 [PubMed 15262227]).[supplied by OMIM
• Molecular Mass: 39.93 kDa
• AA Sequence: MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ISCA1 iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ISCA1
• Synonyms: ISCA1; iron-sulfur cluster assembly 1 homolog (S. cerevisiae); HBLD2, HESB like domain containing 2; iron-sulfur cluster assembly 1 homolog, mitochondrial; hIscA; ISA1; MGC4276; HESB like domain containing 2; iron sulfur assembly protein IscA; iron-sulfur assembly protein IscA; HESB-like domain-containing protein 2; HBLD2; RP11-507D14.2
• Gene ID: 81689
• mRNA Refseq: NM_030940
• Protein Refseq: NP_112202
• MIM: 611006
• UniProt ID: Q9BUE6