Recombinant Human ISCA1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ISCA1-3241H
• Product Overview: ISCA1 MS Standard C13 and N15-labeled recombinant protein (NP_112202) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions.
• Molecular Mass: 14.2 kDa
• AA Sequence: MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ISCA1 iron-sulfur cluster assembly 1 [ Homo sapiens (human) ]
• Official Symbol: ISCA1
• Synonyms: ISCA1; iron-sulfur cluster assembly 1 homolog (S. cerevisiae); HBLD2, HESB like domain containing 2; iron-sulfur cluster assembly 1 homolog, mitochondrial; hIscA; ISA1; MGC4276; HESB like domain containing 2; iron sulfur assembly protein IscA; iron-sulfur assembly protein IscA; HESB-like domain-containing protein 2; HBLD2; RP11-507D14.2
• Gene ID: 81689
• mRNA Refseq: NM_030940
• Protein Refseq: NP_112202
• MIM: 611006
• UniProt ID: Q9BUE6