Recombinant Full Length Human INSL5 Protein, GST-tagged

• Cat.No.: INSL5-5987HF
• Product Overview: Human INSL5 full-length ORF ( NP_005469, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 135 amino acids
• Description: The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeq
• Molecular Mass: 40.48 kDa
• AA Sequence: MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INSL5 insulin-like 5 [ Homo sapiens ]
• Official Symbol: INSL5
• Synonyms: INSL5; insulin-like 5; insulin-like peptide INSL5; insulin-like peptide 5; PRO182; UNQ156; MGC126695; MGC126697
• Gene ID: 10022
• mRNA Refseq: NM_005478
• Protein Refseq: NP_005469
• MIM: 606413
• UniProt ID: Q9Y5Q6